PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_016206-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 353aa    MW: 40188.7 Da    PI: 9.0902
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_016206-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.7e-174287147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed++l+++v q+G+ +W++Ia+ ++ gR++k+c++rw++ 
  AHYPO_016206-RA 42 RGHWRPAEDDKLKQLVLQFGPQNWNLIAQNLQ-GRSGKSCRLRWYNQ 87
                     899*****************************.************96 PP

2Myb_DNA-binding57.14.2e-1895136245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++T+eE+e+l++a++++G++ W+ Iar ++ gRt++ +k++w+
  AHYPO_016206-RA  95 TAFTEEEEERLKEAHRMYGNK-WAIIARLFP-GRTDNAVKNHWH 136
                      689******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9453788IPR017930Myb domain
SMARTSM007177.8E-144190IPR001005SANT/Myb domain
SuperFamilySSF466895.62E-2842135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-264394IPR009057Homeodomain-like
CDDcd001676.61E-124586No hitNo description
PfamPF139213.6E-1645105No hitNo description
PROSITE profilePS5129426.91289143IPR017930Myb domain
SMARTSM007172.7E-1693141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2095138IPR009057Homeodomain-like
CDDcd001679.74E-7105138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
INFETTISPV LDLCLSTKQI TNLDVSQTKN GSLQKTNKVC CRGHWRPAED DKLKQLVLQF  60
GPQNWNLIAQ NLQGRSGKSC RLRWYNQLDP KINKTAFTEE EEERLKEAHR MYGNKWAIIA  120
RLFPGRTDNA VKNHWHVMNA RLEREKSCFF SRKRNSNNKI KHQHHNNHNH NYENNVMMMF  180
KKQKIISKEN TGSRGESSTT ISSTIIINNQ NNNNNNNNNN NNNVECTDLT LSTNSPLDGN  240
GNGKMGKGNE RKTVLDGCQQ QHLHHQPCSS DRQKGTIEES MWKSSRNKNG EKDEAMEIIT  300
FKELSDSNSE GSGIADSVVN SGYYESYCPT KNGKLVNITF FDFLGLEPTS FS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32401355100B-MYB
1mse_C2e-3239135197C-Myb DNA-Binding Domain
1msf_C2e-3239135197C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695522.12e-85PREDICTED: myb-like protein Q
TrEMBLA0A0J8B9J12e-85A0A0J8B9J1_BETVU; Uncharacterized protein
STRINGLOC_Os01g16810.12e-63(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-57myb domain protein 105